Lineage for d3g9qa1 (3g9q A:54-315)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143580Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2143581Protein automated matches [190944] (35 species)
    not a true protein
  7. 2143592Species Bacillus subtilis [TaxId:224308] [232282] (2 PDB entries)
  8. 2143595Domain d3g9qa1: 3g9q A:54-315 [246271]
    Other proteins in same PDB: d3g9qa2
    automated match to d3gfva_

Details for d3g9qa1

PDB Entry: 3g9q (more details), 2.6 Å

PDB Description: crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577a
PDB Compounds: (A:) Ferrichrome-binding protein

SCOPe Domain Sequences for d3g9qa1:

Sequence, based on SEQRES records: (download)

>d3g9qa1 c.92.2.0 (A:54-315) automated matches {Bacillus subtilis [TaxId: 224308]}
ipkhpkrvvvmadgyygyfktlginvvgapenvfknpyykgktngvenigdgtsvekvid
lnpdliivwttqgadikklekiaptvavkydkldnieqlkefakmtgtedkaekwlakwd
kkvaaaktkikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqatkltkekai
dqgpgytsisleklpdfagdyifagpwqsggddggvfessiwknlnavknghvykmdpig
fyftdpislegqlefitesltk

Sequence, based on observed residues (ATOM records): (download)

>d3g9qa1 c.92.2.0 (A:54-315) automated matches {Bacillus subtilis [TaxId: 224308]}
ipkhpkrvvvmadgyygyfktlginvvgapenvfknpyykgktngvenigdgtsvekvid
lnpdliivwttadikklekiaptvavkydkldnieqlkefakmtgtedkaekwlakwdkk
vaaaktkikkavgdktisimqtngkdiyvfgkdfgrggsiiykdlglqatkltkekaidq
gpgytsisleklpdfagdyifagpwqsggvfessiwknlnavknghvykmdpigfyftdp
islegqlefitesltk

SCOPe Domain Coordinates for d3g9qa1:

Click to download the PDB-style file with coordinates for d3g9qa1.
(The format of our PDB-style files is described here.)

Timeline for d3g9qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g9qa2