Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) |
Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein) |
Protein DNA-binding domain of retroviral integrase [50124] (3 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (4 PDB entries) |
Domain d1ex4a1: 1ex4 A:223-270 [24627] Other proteins in same PDB: d1ex4a2, d1ex4b2 complexed with cps |
PDB Entry: 1ex4 (more details), 2.8 Å
SCOPe Domain Sequences for d1ex4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ex4a1 b.34.7.1 (A:223-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]} frvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiird
Timeline for d1ex4a1: