Lineage for d1ex4a1 (1ex4 A:223-270)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13313Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (1 family) (S)
  5. 13314Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
  6. 13315Protein DNA-binding domain of retroviral integrase [50124] (3 species)
  7. 13316Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (4 PDB entries)
  8. 13317Domain d1ex4a1: 1ex4 A:223-270 [24627]
    Other proteins in same PDB: d1ex4a2, d1ex4b2

Details for d1ex4a1

PDB Entry: 1ex4 (more details), 2.8 Å

PDB Description: hiv-1 integrase catalytic core and c-terminal domain

SCOP Domain Sequences for d1ex4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ex4a1 b.34.7.1 (A:223-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1}
frvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiird

SCOP Domain Coordinates for d1ex4a1:

Click to download the PDB-style file with coordinates for d1ex4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ex4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ex4a2