SCOPe 2.08: Domain d1ex4a1: 1ex4 A:223-270

Lineage for d1ex4a1 (1ex4 A:223-270)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
   Pfam PF00552, Pfam PF18103

6. Protein DNA-binding domain of retroviral integrase [50124] (4 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50125] (8 PDB entries)

8. Domain d1ex4a1: 1ex4 A:223-270 [24627]
   Other proteins in same PDB: d1ex4a2, d1ex4b2
   complexed with cps

Details for d1ex4a1

PDB Entry: 1ex4, 2.8 Å

PDB Description: hiv-1 integrase catalytic core and c-terminal domain

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d1ex4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ex4a1 b.34.7.1 (A:223-270) DNA-binding domain of retroviral integrase {Human immunodeficiency virus type 1 [TaxId: 11676]}
frvyyrdsrnslwkgpakllwkgegavviqdnsdikvvprrkakiird

Timeline for d1ex4a1:

• d1ex4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ex4a1 appears in SCOPe 2.07