SCOPe 2.06: Domain d3g8cb3: 3g8c B:331-444

Lineage for d3g8cb3 (3g8c B:331-444)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.0: automated matches [254217] (1 protein)
   not a true family

6. Protein automated matches [254496] (13 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255843] (2 PDB entries)

8. Domain d3g8cb3: 3g8c B:331-444 [246265]
   Other proteins in same PDB: d3g8ca1, d3g8ca2, d3g8cb1, d3g8cb2
   automated match to d2w70a3
   complexed with adp, bct, btn, mg

Details for d3g8cb3

PDB Entry: 3g8c, 2 Å

PDB Description: crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8cb3:

Sequence; same for both SEQRES and ATOM records:

>d3g8cb3 b.84.2.0 (B:331-444) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl

Timeline for d3g8cb3:

• d3g8cb3 first appeared in SCOPe 2.04
  
• d3g8cb3 appears in SCOPe 2.05
  
• d3g8cb3 appears in SCOPe 2.07
  
• d3g8cb3 appears in the current release, SCOPe 2.08