Lineage for d3g8cb1 (3g8c B:1-114)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591668Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1591669Protein automated matches [226903] (25 species)
    not a true protein
  7. 1591701Species Escherichia coli K-12 [TaxId:83333] [255841] (2 PDB entries)
  8. 1591705Domain d3g8cb1: 3g8c B:1-114 [246263]
    Other proteins in same PDB: d3g8ca2, d3g8ca3, d3g8cb2, d3g8cb3
    automated match to d2w70a1
    complexed with adp, bct, btn, mg

Details for d3g8cb1

PDB Entry: 3g8c (more details), 2 Å

PDB Description: crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8cb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8cb1 c.30.1.0 (B:1-114) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d3g8cb1:

Click to download the PDB-style file with coordinates for d3g8cb1.
(The format of our PDB-style files is described here.)

Timeline for d3g8cb1: