Lineage for d1vubd_ (1vub D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784276Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2784277Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2784278Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)
  8. 2784296Domain d1vubd_: 1vub D: [24626]
    complexed with cl

Details for d1vubd_

PDB Entry: 1vub (more details), 2.6 Å

PDB Description: ccdb, a topoisomerase poison from e. coli
PDB Compounds: (D:) ccdb

SCOPe Domain Sequences for d1vubd_:

Sequence, based on SEQRES records: (download)

>d1vubd_ b.34.6.1 (D:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records): (download)

>d1vubd_ b.34.6.1 (D:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmm
ttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOPe Domain Coordinates for d1vubd_:

Click to download the PDB-style file with coordinates for d1vubd_.
(The format of our PDB-style files is described here.)

Timeline for d1vubd_: