Class g: Small proteins [56992] (94 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (41 PDB entries) |
Domain d3g76h1: 3g76 H:253-356 [246253] Other proteins in same PDB: d3g76b2, d3g76d2, d3g76f2, d3g76h2 automated match to d1tfqa_ complexed with cz3, zn |
PDB Entry: 3g76 (more details), 3 Å
SCOPe Domain Sequences for d3g76h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g76h1 g.52.1.1 (H:253-356) automated matches {Human (Homo sapiens) [TaxId: 9606]} stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp sedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtt
Timeline for d3g76h1: