Lineage for d3g76g_ (3g76 G:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642738Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2642739Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2642740Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2642874Protein automated matches [190700] (1 species)
    not a true protein
  7. 2642875Species Human (Homo sapiens) [TaxId:9606] [187840] (48 PDB entries)
  8. 2642973Domain d3g76g_: 3g76 G: [246252]
    Other proteins in same PDB: d3g76b2, d3g76d2, d3g76f2, d3g76h2
    automated match to d1tfqa_
    complexed with cz3, zn

Details for d3g76g_

PDB Entry: 3g76 (more details), 3 Å

PDB Description: Crystal structure of XIAP-BIR3 in complex with a bivalent compound
PDB Compounds: (G:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3g76g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g76g_ g.52.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
sedpweqhakwypgckylleqkgqeyinnihlths

SCOPe Domain Coordinates for d3g76g_:

Click to download the PDB-style file with coordinates for d3g76g_.
(The format of our PDB-style files is described here.)

Timeline for d3g76g_: