Class g: Small proteins [56992] (91 folds) |
Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) |
Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
Protein automated matches [190700] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187840] (25 PDB entries) |
Domain d3g76e_: 3g76 E: [246250] automated match to d1tfqa_ complexed with cz3, zn |
PDB Entry: 3g76 (more details), 3 Å
SCOPe Domain Sequences for d3g76e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g76e_ g.52.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp sedpweqhakwypgckylleqkgqeyinnihlths
Timeline for d3g76e_: