Lineage for d1vubc_ (1vub C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109630Superfamily b.34.6: CcdB [50118] (1 family) (S)
  5. 109631Family b.34.6.1: CcdB [50119] (1 protein)
  6. 109632Protein CcdB [50120] (1 species)
  7. 109633Species Escherichia coli [TaxId:562] [50121] (4 PDB entries)
  8. 109646Domain d1vubc_: 1vub C: [24625]

Details for d1vubc_

PDB Entry: 1vub (more details), 2.6 Å

PDB Description: ccdb, a topoisomerase poison from e. coli

SCOP Domain Sequences for d1vubc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vubc_ b.34.6.1 (C:) CcdB {Escherichia coli}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOP Domain Coordinates for d1vubc_:

Click to download the PDB-style file with coordinates for d1vubc_.
(The format of our PDB-style files is described here.)

Timeline for d1vubc_: