Lineage for d3g76d_ (3g76 D:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967381Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1967382Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 1967383Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1967517Protein automated matches [190700] (1 species)
    not a true protein
  7. 1967518Species Human (Homo sapiens) [TaxId:9606] [187840] (35 PDB entries)
  8. 1967588Domain d3g76d_: 3g76 D: [246249]
    automated match to d1tfqa_
    complexed with cz3, zn

Details for d3g76d_

PDB Entry: 3g76 (more details), 3 Å

PDB Description: Crystal structure of XIAP-BIR3 in complex with a bivalent compound
PDB Compounds: (D:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d3g76d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g76d_ g.52.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltdwkp
sedpweqhakwypgckylleqkgqeyinnihlthsleeclvrtth

SCOPe Domain Coordinates for d3g76d_:

Click to download the PDB-style file with coordinates for d3g76d_.
(The format of our PDB-style files is described here.)

Timeline for d3g76d_: