Lineage for d3g6je2 (3g6j E:107-214)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751522Domain d3g6je2: 3g6j E:107-214 [246237]
    Other proteins in same PDB: d3g6je1, d3g6jf_, d3g6jg1, d3g6jh_
    automated match to d1dn0a2
    complexed with ca

Details for d3g6je2

PDB Entry: 3g6j (more details), 3.1 Å

PDB Description: C3b in complex with a C3b specific Fab
PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d3g6je2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6je2 b.1.1.2 (E:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d3g6je2:

Click to download the PDB-style file with coordinates for d3g6je2.
(The format of our PDB-style files is described here.)

Timeline for d3g6je2: