Lineage for d3g6je1 (3g6j E:1-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766231Domain d3g6je1: 3g6j E:1-106 [246236]
    Other proteins in same PDB: d3g6je2, d3g6jg2
    automated match to d1dn0a1
    complexed with ca

Details for d3g6je1

PDB Entry: 3g6j (more details), 3.1 Å

PDB Description: C3b in complex with a C3b specific Fab
PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d3g6je1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g6je1 b.1.1.0 (E:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyatlptfeqgtkvei

SCOPe Domain Coordinates for d3g6je1:

Click to download the PDB-style file with coordinates for d3g6je1.
(The format of our PDB-style files is described here.)

Timeline for d3g6je1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g6je2