SCOPe 2.06: Domain d3g0ha1: 3g0h A:60-299

Lineage for d3g0ha1 (3g0h A:60-299)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (124 PDB entries)

8. Domain d3g0ha1: 3g0h A:60-299 [246224]
   automated match to d3fhta1
   protein/RNA complex; complexed with anp, gol, mg

Details for d3g0ha1

PDB Entry: 3g0h, 2.7 Å

PDB Description: Human dead-box RNA helicase DDX19, in complex with an ATP-analogue and RNA

PDB Compounds: (A:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3g0ha1:

Sequence; same for both SEQRES and ATOM records:

>d3g0ha1 c.37.1.0 (A:60-299) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sllnklirsnlvdntnqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiq
enalplmlaeppqnliaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtg
kvieqmgkfypelklayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvf
vldeadvmiatqghqdqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkr

Timeline for d3g0ha1:

• d3g0ha1 first appeared in SCOPe 2.04
  
• d3g0ha1 appears in SCOPe 2.05
  
• d3g0ha1 appears in SCOPe 2.07
  
• d3g0ha1 appears in the current release, SCOPe 2.08