Lineage for d3fznc1 (3fzn C:2-181)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1592643Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1592644Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. Protein automated matches [227126] (15 species)
    not a true protein
  7. Species Pseudomonas putida [TaxId:303] [254984] (28 PDB entries)
  8. 1593428Domain d3fznc1: 3fzn C:2-181 [246217]
    Other proteins in same PDB: d3fzna2, d3fznb2, d3fznc2, d3fznd2
    automated match to d2fwna2
    complexed with cl, d7k, mg, peg, po4

Details for d3fznc1

PDB Entry: 3fzn (more details), 1.62 Å

PDB Description: intermediate analogue in benzoylformate decarboxylase
PDB Compounds: (C:) Benzoylformate decarboxylase

SCOPe Domain Sequences for d3fznc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fznc1 c.36.1.0 (C:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOPe Domain Coordinates for d3fznc1:

Click to download the PDB-style file with coordinates for d3fznc1.
(The format of our PDB-style files is described here.)

Timeline for d3fznc1: