Lineage for d2vubg_ (2vub G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784601Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 1784602Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 1784603Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 1784604Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)
  8. 1784617Domain d2vubg_: 2vub G: [24621]
    complexed with cl

Details for d2vubg_

PDB Entry: 2vub (more details), 2.45 Å

PDB Description: ccdb, a topoisomerase poison from e. coli
PDB Compounds: (G:) ccdb

SCOPe Domain Sequences for d2vubg_:

Sequence, based on SEQRES records: (download)

>d2vubg_ b.34.6.1 (G:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records): (download)

>d2vubg_ b.34.6.1 (G:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytyyrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdeswrmmt
tdmasvpvsvigeevadlshrendiknainlmfwgi

SCOPe Domain Coordinates for d2vubg_:

Click to download the PDB-style file with coordinates for d2vubg_.
(The format of our PDB-style files is described here.)

Timeline for d2vubg_: