Lineage for d3fz8e_ (3fz8 E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867167Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 1867178Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 1867179Species Escherichia coli K-12 [TaxId:83333] [188775] (3 PDB entries)
  8. 1867196Domain d3fz8e_: 3fz8 E: [246209]
    automated match to d3fz7f_
    complexed with plr

Details for d3fz8e_

PDB Entry: 3fz8 (more details), 3 Å

PDB Description: crystal structure of glutamate decarboxylase beta from escherichia coli: reduced schiff base with plp
PDB Compounds: (E:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fz8e_ c.67.1.6 (E:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlat
fcqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtn
tigsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipm
rpgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhi
daasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfn
vdylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgp
yefictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmr
imcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht

SCOPe Domain Coordinates for d3fz8e_:

Click to download the PDB-style file with coordinates for d3fz8e_.
(The format of our PDB-style files is described here.)

Timeline for d3fz8e_: