SCOPe 2.05: Domain d3fz8d_: 3fz8 D:

Lineage for d3fz8d_ (3fz8 D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
   automatically mapped to Pfam PF00282

6. Protein Glutamate decarboxylase beta, GadB [102596] (2 species)

7. Species Escherichia coli K-12 [TaxId:83333] [188775] (3 PDB entries)

8. Domain d3fz8d_: 3fz8 D: [246208]
   automated match to d3fz7f_
   complexed with plr

Details for d3fz8d_

PDB Entry: 3fz8, 3 Å

PDB Description: crystal structure of glutamate decarboxylase beta from escherichia coli: reduced schiff base with plp

PDB Compounds: (D:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz8d_:

Sequence; same for both SEQRES and ATOM records:

>d3fz8d_ c.67.1.6 (D:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
dfaellledykaslkylsdhpklqgiaqqnsfkht

Timeline for d3fz8d_:

• d3fz8d_ first appeared in SCOPe 2.04
  
• d3fz8d_ appears in SCOPe 2.06
  
• d3fz8d_ appears in the current release, SCOPe 2.08