Lineage for d3fz8c_ (3fz8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896540Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 proteins)
    automatically mapped to Pfam PF00282
  6. 2896551Protein Glutamate decarboxylase beta, GadB [102596] (2 species)
  7. 2896552Species Escherichia coli K-12 [TaxId:83333] [188775] (3 PDB entries)
  8. 2896567Domain d3fz8c_: 3fz8 C: [246207]
    automated match to d3fz7f_
    complexed with plr

Details for d3fz8c_

PDB Entry: 3fz8 (more details), 3 Å

PDB Description: crystal structure of glutamate decarboxylase beta from escherichia coli: reduced schiff base with plp
PDB Compounds: (C:) Glutamate decarboxylase beta

SCOPe Domain Sequences for d3fz8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fz8c_ c.67.1.6 (C:) Glutamate decarboxylase beta, GadB {Escherichia coli K-12 [TaxId: 83333]}
elldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwdden
vhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtntigsseacm
lggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmrpgqlfmdp
krmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhidaasggfla
pfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnvdylggqig
tfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpyefictgrp
degipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmrimcrrgfem
dfaellledykaslkylsdhpklqgiaqqnsfkht

SCOPe Domain Coordinates for d3fz8c_:

Click to download the PDB-style file with coordinates for d3fz8c_.
(The format of our PDB-style files is described here.)

Timeline for d3fz8c_: