| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (71 species) not a true protein |
| Species Oceanobacillus iheyensis [TaxId:221109] [255838] (3 PDB entries) |
| Domain d3fyyb2: 3fyy B:123-375 [246204] Other proteins in same PDB: d3fyya1, d3fyyb1 automated match to d3sjna2 complexed with mg |
PDB Entry: 3fyy (more details), 1.8 Å
SCOPe Domain Sequences for d3fyyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyyb2 c.1.11.0 (B:123-375) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
rvkekikvcypifrhrfseevesnldvvrqkleqgfdvfrlyvgknldadeeflsrvkee
fgsrvriksydfshllnwkdahraikrltkydlglemiespaprndfdglyqlrlktdyp
isehvwsfkqqqemikkdaidifnispvfiggltsakkaayaaevaskdvvlgttqelsv
gtaamahlgcsltninhtsdptgpelyvgdvvknrvtykdgylyapdrsvkglgieldes
llakyqvpdlswd
Timeline for d3fyyb2: