Lineage for d3fysa1 (3fys A:1-281)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529004Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
    2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]
  4. 2529005Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) (S)
    domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different
  5. 2529052Family c.119.1.0: automated matches [191443] (1 protein)
    not a true family
  6. 2529053Protein automated matches [190655] (13 species)
    not a true protein
  7. 2529054Species Bacillus subtilis [TaxId:1423] [255836] (1 PDB entry)
  8. 2529055Domain d3fysa1: 3fys A:1-281 [246200]
    Other proteins in same PDB: d3fysa2
    automated match to d1pzxb_
    complexed with br, edo, plm

Details for d3fysa1

PDB Entry: 3fys (more details), 2.5 Å

PDB Description: Crystal Structure of DegV, a fatty acid binding protein from Bacillus subtilis
PDB Compounds: (A:) Protein degV

SCOPe Domain Sequences for d3fysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fysa1 c.119.1.0 (A:1-281) automated matches {Bacillus subtilis [TaxId: 1423]}
mniavvtdstayipkemreqhqihmiplqvvfreetyreeieldwksfyeevkkhnelpt
tsqppigelvalyeelgksydavisihlssgisgtfssaaaadsmvdnidvypfdseisc
laqgfyalkaaelikngasspediikeleemkktvrayfmvddlahlqrggrlssaqafi
gsllkvkpilhfdnkvivpfekirtrkkaisriyelldedaskglpmraavihanreeea
akiieelsakyphvefynsyfgavigthlgegalgicwcfk

SCOPe Domain Coordinates for d3fysa1:

Click to download the PDB-style file with coordinates for d3fysa1.
(The format of our PDB-style files is described here.)

Timeline for d3fysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fysa2