SCOPe 2.04: Domain d3fysa_: 3fys A:

Lineage for d3fysa_ (3fys A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.119: DAK1/DegV-like [82548] (1 superfamily)
   2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest]

4. Superfamily c.119.1: DAK1/DegV-like [82549] (3 families)
   domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different

5. Family c.119.1.0: automated matches [191443] (1 protein)
   not a true family

6. Protein automated matches [190655] (9 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255836] (1 PDB entry)

8. Domain d3fysa_: 3fys A: [246200]
   automated match to d1pzxb_
   complexed with br, edo, plm

Details for d3fysa_

PDB Entry: 3fys, 2.5 Å

PDB Description: Crystal Structure of DegV, a fatty acid binding protein from Bacillus subtilis

PDB Compounds: (A:) Protein degV

SCOPe Domain Sequences for d3fysa_:

Sequence; same for both SEQRES and ATOM records:

>d3fysa_ c.119.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
smniavvtdstayipkemreqhqihmiplqvvfreetyreeieldwksfyeevkkhnelp
ttsqppigelvalyeelgksydavisihlssgisgtfssaaaadsmvdnidvypfdseis
claqgfyalkaaelikngasspediikeleemkktvrayfmvddlahlqrggrlssaqaf
igsllkvkpilhfdnkvivpfekirtrkkaisriyelldedaskglpmraavihanreee
aakiieelsakyphvefynsyfgavigthlgegalgicwcfk

Timeline for d3fysa_:

• d3fysa_ is new in SCOPe 2.04-stable
  
• d3fysa_ appears in SCOPe 2.05
  
• d3fysa_ appears in the current release, SCOPe 2.08, called d3fysa1