SCOPe 2.04: Domain d3fyaa_: 3fya A:

Lineage for d3fyaa_ (3fya A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (7 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d3fyaa_: 3fya A: [246198]
   automated match to d4i6ua_
   mutant

Details for d3fyaa_

PDB Entry: 3fya, 3 Å

PDB Description: crystal structure of an r35a mutant of the restriction-modification controller protein c.esp1396i

PDB Compounds: (A:) Regulatory protein

SCOPe Domain Sequences for d3fyaa_:

Sequence; same for both SEQRES and ATOM records:

>d3fyaa_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldatyisgiernsrnltikslelimkgle
vsdvvffemlikeil

Timeline for d3fyaa_:

• d3fyaa_ is new in SCOPe 2.04-stable
  
• d3fyaa_ appears in SCOPe 2.05
  
• d3fyaa_ appears in the current release, SCOPe 2.08