![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (21 species) not a true protein |
![]() | Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries) |
![]() | Domain d3fyaa_: 3fya A: [246198] automated match to d4i6ua_ mutant |
PDB Entry: 3fya (more details), 3 Å
SCOPe Domain Sequences for d3fyaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fyaa_ a.35.1.0 (A:) automated matches {Enterobacter sp. [TaxId: 211595]} esfllskvsfvikkirlekgmtqedlayksnldatyisgiernsrnltikslelimkgle vsdvvffemlikeil
Timeline for d3fyaa_: