Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.219: PP2C-like [81607] (1 superfamily) 4 layers: alpha/beta/beta/alpha; antiparallel beta sheets |
Superfamily d.219.1: PP2C-like [81606] (2 families) contain binuclear metal (Mn) centre |
Family d.219.1.1: PP2C-like [81605] (3 proteins) Pfam PF00481 |
Protein automated matches [232201] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [232202] (8 PDB entries) |
Domain d3fxma1: 3fxm A:2-296 [246194] Other proteins in same PDB: d3fxma2 automated match to d3fxja1 complexed with flc, mn, po4 |
PDB Entry: 3fxm (more details), 2.5 Å
SCOPe Domain Sequences for d3fxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fxma1 d.219.1.1 (A:2-296) automated matches {Human (Homo sapiens) [TaxId: 9606]} gafldkpkmekhnaqgqgnglryglssmqgwrvemedahtaviglpsgleswsffavydg hagsqvakyccehlldhitnnqdfkgsagapsvenvkngirtgfleidehmrvmsekkhg adrsgstavgvlispqhtyfincgdsrgllcrnrkvhfftqdhkpsnplekeriqnaggs vmiqrvngslavsralgdfdykcvhgkgpteqlvspepevhdierseeddqfiilacdgi wdvmgneelcdfvrsrlevtddlekvcnevvdtclykgsrdnmsvilicfpnapk
Timeline for d3fxma1: