Lineage for d3fxla2 (3fxl A:297-368)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507347Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 1507348Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families) (S)
    automatically mapped to Pfam PF07830
  5. 1507353Family a.159.1.0: automated matches [232204] (1 protein)
    not a true family
  6. 1507354Protein automated matches [232205] (1 species)
    not a true protein
  7. 1507355Species Human (Homo sapiens) [TaxId:9606] [232206] (5 PDB entries)
  8. 1507357Domain d3fxla2: 3fxl A:297-368 [246193]
    Other proteins in same PDB: d3fxla1
    automated match to d3fxja2
    complexed with flc, mn, po4

Details for d3fxla2

PDB Entry: 3fxl (more details), 2.3 Å

PDB Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Citrate at 1 mM of Mn2+
PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d3fxla2:

Sequence, based on SEQRES records: (download)

>d3fxla2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records): (download)

>d3fxla2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

SCOPe Domain Coordinates for d3fxla2:

Click to download the PDB-style file with coordinates for d3fxla2.
(The format of our PDB-style files is described here.)

Timeline for d3fxla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fxla1