SCOPe 2.08: Domain d3fxla2: 3fxl A:297-368

Lineage for d3fxla2 (3fxl A:297-368)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
   topologically similar to the DNA/RNA-binding bundles; distinct packing

4. Superfamily a.159.1: Protein serine/threonine phosphatase 2C, C-terminal domain [81601] (2 families)
   automatically mapped to Pfam PF07830

5. Family a.159.1.0: automated matches [232204] (1 protein)
   not a true family

6. Protein automated matches [232205] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232206] (8 PDB entries)

8. Domain d3fxla2: 3fxl A:297-368 [246193]
   Other proteins in same PDB: d3fxla1
   automated match to d3fxja2
   complexed with flc, mn, po4

Details for d3fxla2

PDB Entry: 3fxl, 2.3 Å

PDB Description: Crystal Structure of Human Protein phosphatase 1A (PPM1A) Bound with Citrate at 1 mM of Mn2+

PDB Compounds: (A:) Protein phosphatase 1A

SCOPe Domain Sequences for d3fxla2:

Sequence, based on SEQRES records:

>d3fxla2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikkqgegvpdlvhvmrtlasenipslppggelaskrn
vieavynrlnpy

Sequence, based on observed residues (ATOM records):

>d3fxla2 a.159.1.0 (A:297-368) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vspeavkkeaeldkylecrveeiikgvpdlvhvmrtlasenipslppggelaskrnviea
vynrlnpy

Timeline for d3fxla2:

• d3fxla2 first appeared in SCOPe 2.04
  
• d3fxla2 appears in SCOPe 2.07