Lineage for d3fvda1 (3fvd A:2-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948495Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries)
  8. 2948520Domain d3fvda1: 3fvd A:2-127 [246188]
    Other proteins in same PDB: d3fvda2, d3fvda3, d3fvda4, d3fvdb2, d3fvdb3, d3fvdb4
    automated match to d2qdda1
    complexed with mg

Details for d3fvda1

PDB Entry: 3fvd (more details), 2.3 Å

PDB Description: crystal structure of a member of enolase superfamily from roseovarius nubinhibens ism complexed with magnesium
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fvda1:

Sequence, based on SEQRES records: (download)

>d3fvda1 d.54.1.0 (A:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsylpah
gpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglpl
wqllgg

Sequence, based on observed residues (ATOM records): (download)

>d3fvda1 d.54.1.0 (A:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
ritrltvfhldlplakpfdrldstylridtdegvtgwgegcpwghsylpahgpglragia
tlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwqllgg

SCOPe Domain Coordinates for d3fvda1:

Click to download the PDB-style file with coordinates for d3fvda1.
(The format of our PDB-style files is described here.)

Timeline for d3fvda1: