![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries) |
![]() | Domain d3fvda1: 3fvd A:2-127 [246188] Other proteins in same PDB: d3fvda2, d3fvda3, d3fvda4, d3fvdb2, d3fvdb3, d3fvdb4 automated match to d2qdda1 complexed with mg |
PDB Entry: 3fvd (more details), 2.3 Å
SCOPe Domain Sequences for d3fvda1:
Sequence, based on SEQRES records: (download)
>d3fvda1 d.54.1.0 (A:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} ritrltvfhldlplakpywlsggrlkfdrldstylridtdegvtgwgegcpwghsylpah gpglragiatlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglpl wqllgg
>d3fvda1 d.54.1.0 (A:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} ritrltvfhldlplakpfdrldstylridtdegvtgwgegcpwghsylpahgpglragia tlaphllgldprsldhvnrvmdlqlpghsyvkspidmacwdilgqvaglplwqllgg
Timeline for d3fvda1:
![]() Domains from other chains: (mouse over for more information) d3fvdb1, d3fvdb2, d3fvdb3, d3fvdb4 |