SCOPe 2.06: Domain d3fpxa3: 3fpx A:301-499

Lineage for d3fpxa3 (3fpx A:301-499)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (23 species)
   not a true protein

7. Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries)

8. Domain d3fpxa3: 3fpx A:301-499 [246183]
   automated match to d1kyaa3
   complexed with cu, nag, po4

Details for d3fpxa3

PDB Entry: 3fpx, 1.8 Å

PDB Description: native fungus laccase from trametes hirsuta

PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d3fpxa3:

Sequence; same for both SEQRES and ATOM records:

>d3fpxa3 b.6.1.0 (A:301-499) automated matches {Trametes hirsuta [TaxId: 5327]}
nevdlhplvstpvpgspssggvdkainmafnfngsnffingasfvpptvpvllqilsgaq
taqdllpsgsvyvlpsnasieisfpataaapgaphpfhlhghtfavvrsagstvynydnp
ifrdvvstgtpaagdnvtirfdtnnpgpwflhchidfhleggfavvmaedtpdvkavnpv
pqawsdlcptydaldpndq

Timeline for d3fpxa3:

• d3fpxa3 first appeared in SCOPe 2.04
  
• d3fpxa3 appears in SCOPe 2.05
  
• d3fpxa3 appears in SCOPe 2.07
  
• d3fpxa3 appears in the current release, SCOPe 2.08