Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (23 species) not a true protein |
Species Trametes hirsuta [TaxId:5327] [255835] (4 PDB entries) |
Domain d3fpxa3: 3fpx A:301-499 [246183] automated match to d1kyaa3 complexed with cu, nag, po4 |
PDB Entry: 3fpx (more details), 1.8 Å
SCOPe Domain Sequences for d3fpxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fpxa3 b.6.1.0 (A:301-499) automated matches {Trametes hirsuta [TaxId: 5327]} nevdlhplvstpvpgspssggvdkainmafnfngsnffingasfvpptvpvllqilsgaq taqdllpsgsvyvlpsnasieisfpataaapgaphpfhlhghtfavvrsagstvynydnp ifrdvvstgtpaagdnvtirfdtnnpgpwflhchidfhleggfavvmaedtpdvkavnpv pqawsdlcptydaldpndq
Timeline for d3fpxa3: