Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (14 species) not a true protein |
Species Escherichia coli [TaxId:199310] [255834] (1 PDB entry) |
Domain d3fnab_: 3fna B: [246172] automated match to d4o9kb_ complexed with amp |
PDB Entry: 3fna (more details), 2.1 Å
SCOPe Domain Sequences for d3fnab_:
Sequence, based on SEQRES records: (download)
>d3fnab_ d.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 199310]} grklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgdl rrvfdmgvdvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvlh mhdllr
>d3fnab_ d.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 199310]} grklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgdl rrvfdmvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvlhmhd llr
Timeline for d3fnab_: