Lineage for d3fnab_ (3fna B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167405Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2167406Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2167576Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2167577Protein automated matches [191100] (14 species)
    not a true protein
  7. 2167602Species Escherichia coli [TaxId:199310] [255834] (1 PDB entry)
  8. 2167604Domain d3fnab_: 3fna B: [246172]
    automated match to d4o9kb_
    complexed with amp

Details for d3fnab_

PDB Entry: 3fna (more details), 2.1 Å

PDB Description: crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073
PDB Compounds: (B:) Possible arabinose 5-phosphate isomerase

SCOPe Domain Sequences for d3fnab_:

Sequence, based on SEQRES records: (download)

>d3fnab_ d.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 199310]}
grklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgdl
rrvfdmgvdvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvlh
mhdllr

Sequence, based on observed residues (ATOM records): (download)

>d3fnab_ d.37.1.0 (B:) automated matches {Escherichia coli [TaxId: 199310]}
grklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgdl
rrvfdmvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvlhmhd
llr

SCOPe Domain Coordinates for d3fnab_:

Click to download the PDB-style file with coordinates for d3fnab_.
(The format of our PDB-style files is described here.)

Timeline for d3fnab_: