SCOPe 2.06: Domain d3fnaa_: 3fna A:

Lineage for d3fnaa_ (3fna A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (14 species)
   not a true protein

7. Species Escherichia coli [TaxId:199310] [255834] (1 PDB entry)

8. Domain d3fnaa_: 3fna A: [246171]
   automated match to d4o9kb_
   complexed with amp

Details for d3fnaa_

PDB Entry: 3fna, 2.1 Å

PDB Description: crystal structure of the cbs pair of possible d-arabinose 5-phosphate isomerase yrbh from escherichia coli cft073

PDB Compounds: (A:) Possible arabinose 5-phosphate isomerase

SCOPe Domain Sequences for d3fnaa_:

Sequence, based on SEQRES records:

>d3fnaa_ d.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 199310]}
lgrklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgd
lrrvfdmgvdvrrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvl
hmhdll

Sequence, based on observed residues (ATOM records):

>d3fnaa_ d.37.1.0 (A:) automated matches {Escherichia coli [TaxId: 199310]}
lgrklllrvndimhtgdeiphvkktaslrdallevtrknlgmtvicddnmmiegiftdgd
lrrvfdrlsiadvmtpggirvrpgilavealnlmqsrhitsvmvadgdhllgvlhmhdll

Timeline for d3fnaa_:

• d3fnaa_ first appeared in SCOPe 2.04
  
• d3fnaa_ appears in SCOPe 2.05
  
• d3fnaa_ appears in SCOPe 2.07
  
• d3fnaa_ appears in the current release, SCOPe 2.08