Lineage for d2vubc_ (2vub C:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13295Superfamily b.34.6: CcdB [50118] (1 family) (S)
  5. 13296Family b.34.6.1: CcdB [50119] (1 protein)
  6. 13297Protein CcdB [50120] (1 species)
  7. 13298Species Escherichia coli [TaxId:562] [50121] (4 PDB entries)
  8. 13303Domain d2vubc_: 2vub C: [24617]

Details for d2vubc_

PDB Entry: 2vub (more details), 2.45 Å

PDB Description: ccdb, a topoisomerase poison from e. coli

SCOP Domain Sequences for d2vubc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vubc_ b.34.6.1 (C:) CcdB {Escherichia coli}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

SCOP Domain Coordinates for d2vubc_:

Click to download the PDB-style file with coordinates for d2vubc_.
(The format of our PDB-style files is described here.)

Timeline for d2vubc_: