| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
| Family b.34.6.1: CcdB [50119] (1 protein) automatically mapped to Pfam PF01845 |
| Protein CcdB [50120] (2 species) topoisomerase poison |
| Species Escherichia coli [TaxId:562] [50121] (7 PDB entries) |
| Domain d2vubc_: 2vub C: [24617] complexed with cl |
PDB Entry: 2vub (more details), 2.45 Å
SCOPe Domain Sequences for d2vubc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vubc_ b.34.6.1 (C:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
Timeline for d2vubc_: