Class a: All alpha proteins [46456] (286 folds) |
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) |
Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
Protein automated matches [226932] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225230] (7 PDB entries) |
Domain d3fk2d_: 3fk2 D: [246164] automated match to d3byic_ complexed with unx |
PDB Entry: 3fk2 (more details), 2.8 Å
SCOPe Domain Sequences for d3fk2d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fk2d_ a.116.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wesnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdq dhnldlaekdftvntvagamksffselpdplvpynmqidlveahkindreqklhalkevl kkfpkenhevfkyvishlnkvshnnkvnlmtsenlsicfwptlmrpdfstmdaltatrty qtiielfiqqcpfffy
Timeline for d3fk2d_: