Lineage for d3fk2a_ (3fk2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725242Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily)
    multihelical
  4. 2725243Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) (S)
  5. 2725299Family a.116.1.0: automated matches [227202] (1 protein)
    not a true family
  6. 2725300Protein automated matches [226932] (4 species)
    not a true protein
  7. 2725303Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries)
  8. 2725325Domain d3fk2a_: 3fk2 A: [246161]
    automated match to d3byic_
    complexed with unx

Details for d3fk2a_

PDB Entry: 3fk2 (more details), 2.8 Å

PDB Description: crystal structure of the rhogap domain of human glucocorticoid receptor dna-binding factor 1
PDB Compounds: (A:) Glucocorticoid receptor DNA-binding factor 1

SCOPe Domain Sequences for d3fk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fk2a_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wesnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdq
dhnldlaekdftvntvagamksffselpdplvpynmqidlveahkindreqklhalkevl
kkfpkenhevfkyvishlnkvshnnkvnlmtsenlsicfwptlmrpdfstmdaltatrty
qtiielfiqqcpfffy

SCOPe Domain Coordinates for d3fk2a_:

Click to download the PDB-style file with coordinates for d3fk2a_.
(The format of our PDB-style files is described here.)

Timeline for d3fk2a_: