| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) ![]() |
| Family a.116.1.0: automated matches [227202] (1 protein) not a true family |
| Protein automated matches [226932] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225230] (14 PDB entries) |
| Domain d3fk2a_: 3fk2 A: [246161] automated match to d3byic_ complexed with unx |
PDB Entry: 3fk2 (more details), 2.8 Å
SCOPe Domain Sequences for d3fk2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fk2a_ a.116.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wesnyfgvplttvvtpekpipifiercieyieatglstegiyrvsgnksemeslqrqfdq
dhnldlaekdftvntvagamksffselpdplvpynmqidlveahkindreqklhalkevl
kkfpkenhevfkyvishlnkvshnnkvnlmtsenlsicfwptlmrpdfstmdaltatrty
qtiielfiqqcpfffy
Timeline for d3fk2a_: