Lineage for d3fjoa3 (3fjo A:499-657)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2105299Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255833] (1 PDB entry)
  8. 2105300Domain d3fjoa3: 3fjo A:499-657 [246160]
    Other proteins in same PDB: d3fjoa1, d3fjoa2
    automated match to d1j9za3
    complexed with fad, fmn

Details for d3fjoa3

PDB Entry: 3fjo (more details), 2.5 Å

PDB Description: structure of chimeric yh cpr
PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d3fjoa3:

Sequence, based on SEQRES records: (download)

>d3fjoa3 c.25.1.0 (A:499-657) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsreqshkvyvqhllkqdrehlwklieggahiyvcgdarnmard
vqntfydivaelgamehaqavdyikklmtkgrysldvws

Sequence, based on observed residues (ATOM records): (download)

>d3fjoa3 c.25.1.0 (A:499-657) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
rlpfkattpvimvgpgtgvapfigfiqerawlrqqgkevgetllyygcrrsdedylyree
laqfhrdgaltqlnvafsrhkvyvqhllkqdrehlwklieggahiyvcgdarnmardvqn
tfydivaelgamehaqavdyikklmtkgrysldvws

SCOPe Domain Coordinates for d3fjoa3:

Click to download the PDB-style file with coordinates for d3fjoa3.
(The format of our PDB-style files is described here.)

Timeline for d3fjoa3: