Lineage for d3fjoa2 (3fjo A:220-498)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054656Family b.43.4.1: NADPH-cytochrome p450 reductase FAD-binding domain-like [50438] (4 protein domains)
    there is an alpha-helical subdomain inserted in this domain
    automatically mapped to Pfam PF00667
  6. 2054677Protein automated matches [227066] (3 species)
    not a true protein
  7. 2054678Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255832] (1 PDB entry)
  8. 2054679Domain d3fjoa2: 3fjo A:220-498 [246159]
    Other proteins in same PDB: d3fjoa1, d3fjoa3
    automated match to d1j9za1
    complexed with fad, fmn

Details for d3fjoa2

PDB Entry: 3fjo (more details), 2.5 Å

PDB Description: structure of chimeric yh cpr
PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d3fjoa2:

Sequence, based on SEQRES records: (download)

>d3fjoa2 b.43.4.1 (A:220-498) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
tkagrinkgvatnwlrakepagenggralvpmfvrksqf

Sequence, based on observed residues (ATOM records): (download)

>d3fjoa2 b.43.4.1 (A:220-498) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ssirqyelvvhtdidaakvymgemgrlksyenqkppfdaknpflaavttnrklnqgterh
lmhleldisdskiryesgdhvavypandsalvnqlgkilgadldvvmslnnldeesnkkh
pfpcptsyrtaltyylditnpprtnvlyelaqyasepseqellrkmasssgegkelylsw
vvearrhilailqdcpslrppidhlcellprlqaryysiassskvhpnsvhicavvveye
tkagrinkgvatnwlrakeparalvpmfvrksqf

SCOPe Domain Coordinates for d3fjoa2:

Click to download the PDB-style file with coordinates for d3fjoa2.
(The format of our PDB-style files is described here.)

Timeline for d3fjoa2: