SCOPe 2.04: Domain d3fjoa1: 3fjo A:47-219

Lineage for d3fjoa1 (3fjo A:47-219)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (17 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255831] (1 PDB entry)

8. Domain d3fjoa1: 3fjo A:47-219 [246158]
   Other proteins in same PDB: d3fjoa2, d3fjoa3
   automated match to d1ja1a2
   complexed with fad, fmn

Details for d3fjoa1

PDB Entry: 3fjo, 2.5 Å

PDB Description: structure of chimeric yh cpr

PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d3fjoa1:

Sequence; same for both SEQRES and ATOM records:

>d3fjoa1 c.23.5.0 (A:47-219) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nrdiaqvvtennknylvlyasqtgtaedyakkfskelvakfnlnvmcadvenydfeslnd
vpvivsifistygegdfpdgavnfedficnaeagalsnlrynmfglgnstyeffngaakk
aekhlsaagairlgklgeaddgagttdedymawkdsilevlkdelgveatgee

Timeline for d3fjoa1:

• d3fjoa1 is new in SCOPe 2.04-stable
  
• d3fjoa1 appears in SCOPe 2.05
  
• d3fjoa1 appears in the current release, SCOPe 2.08