SCOPe 2.05: Domain d3fhmb_: 3fhm B:

Lineage for d3fhmb_ (3fhm B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (13 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [255830] (1 PDB entry)

8. Domain d3fhmb_: 3fhm B: [246155]
   automated match to d4o9kb_
   complexed with amp, nai, so4

Details for d3fhmb_

PDB Entry: 3fhm, 2.7 Å

PDB Description: Crystal structure of the CBS-domain containing protein ATU1752 from Agrobacterium tumefaciens

PDB Compounds: (B:) uncharacterized protein ATU1752

SCOPe Domain Sequences for d3fhmb_:

Sequence; same for both SEQRES and ATOM records:

>d3fhmb_ d.37.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
tfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgifterdlvkav
agqgaaslqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrlagiisigd
vvkari

Timeline for d3fhmb_:

• d3fhmb_ first appeared in SCOPe 2.04
  
• d3fhmb_ appears in SCOPe 2.06
  
• d3fhmb_ appears in the current release, SCOPe 2.08