SCOPe 2.04: Domain d3fhma_: 3fhm A:

Lineage for d3fhma_ (3fhm A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.0: automated matches [191603] (1 protein)
   not a true family

6. Protein automated matches [191100] (13 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [255830] (1 PDB entry)

8. Domain d3fhma_: 3fhm A: [246154]
   automated match to d4o9kb_
   complexed with amp, nai, so4

Details for d3fhma_

PDB Entry: 3fhm, 2.7 Å

PDB Description: Crystal structure of the CBS-domain containing protein ATU1752 from Agrobacterium tumefaciens

PDB Compounds: (A:) uncharacterized protein ATU1752

SCOPe Domain Sequences for d3fhma_:

Sequence; same for both SEQRES and ATOM records:

>d3fhma_ d.37.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
nlyfqgmatfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgift
erdlvkavagqgaaslqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrl
agiisigdvvkarige

Timeline for d3fhma_:

• d3fhma_ is new in SCOPe 2.04-stable
  
• d3fhma_ appears in SCOPe 2.05
  
• d3fhma_ appears in the current release, SCOPe 2.08, called d3fhma1