Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries) |
Domain d3fg6g1: 3fg6 G:396-494 [246148] automated match to d1npha1 complexed with ca |
PDB Entry: 3fg6 (more details), 3 Å
SCOPe Domain Sequences for d3fg6g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fg6g1 d.109.1.0 (G:396-494) automated matches {Human (Homo sapiens) [TaxId: 9606]} gkveiwrvenngriqvdqnsygefyggdcyiilytyprgqiiytwqganatrdelttsaf ltvqldrslggqavqirvsqgkepvhllslfkdkpliiy
Timeline for d3fg6g1: