Lineage for d3fg6f1 (3fg6 F:396-494)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969935Family d.109.1.0: automated matches [191561] (1 protein)
    not a true family
  6. 2969936Protein automated matches [190971] (14 species)
    not a true protein
  7. 2969958Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries)
  8. 2969975Domain d3fg6f1: 3fg6 F:396-494 [246145]
    automated match to d1npha1
    complexed with ca

Details for d3fg6f1

PDB Entry: 3fg6 (more details), 3 Å

PDB Description: structure of the c-terminus of adseverin
PDB Compounds: (F:) Adseverin

SCOPe Domain Sequences for d3fg6f1:

Sequence, based on SEQRES records: (download)

>d3fg6f1 d.109.1.0 (F:396-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkveiwrvenngriqvdqnsygefyggdcyiilytyprgqiiytwqganatrdelttsaf
ltvqldrslggqavqirvsqgkepvhllslfkdkpliiy

Sequence, based on observed residues (ATOM records): (download)

>d3fg6f1 d.109.1.0 (F:396-494) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkveiwrvngriqvdqnsygefyggdcyiilytqiiytwqganatrdelttsafltvqld
rslggqavqirvsqgkepvhllslfkdkpliiy

SCOPe Domain Coordinates for d3fg6f1:

Click to download the PDB-style file with coordinates for d3fg6f1.
(The format of our PDB-style files is described here.)

Timeline for d3fg6f1: