| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
| Protein automated matches [190971] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188619] (3 PDB entries) |
| Domain d3fg6c3: 3fg6 C:604-712 [246138] automated match to d1npha3 complexed with ca |
PDB Entry: 3fg6 (more details), 3 Å
SCOPe Domain Sequences for d3fg6c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fg6c3 d.109.1.0 (C:604-712) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lletqaedhpprlygcsnktgrfvieeipgeftqddlaeddvmlldaweqifiwigkdan
evekkeslksakmyletdpsgrdkrtpiviikqghepptftgwflgwds
Timeline for d3fg6c3: