Lineage for d3ffsb_ (3ffs B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2080779Species Cryptosporidium parvum [TaxId:5807] [234914] (4 PDB entries)
  8. 2080792Domain d3ffsb_: 3ffs B: [246129]
    automated match to d1eepa_

Details for d3ffsb_

PDB Entry: 3ffs (more details), 3.19 Å

PDB Description: the crystal structure of cryptosporidium parvum inosine-5'- monophosphate dehydrogenase
PDB Compounds: (B:) Inosine-5-monophosphate dehydrogenase

SCOPe Domain Sequences for d3ffsb_:

Sequence, based on SEQRES records: (download)

>d3ffsb_ c.1.5.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
arlggigiihknmdmesqvnevlkvknwisnleknestpdqnldkestdgkdtksnnnid
aysnenldnkgrlrvgaaigvneierakllveagvdvivldsahghslniirtlkeiksk
mnidvivgnvvteeatkeliengadgikvgigpgsicttrivagvgvpqitaiekcssva
skfgipiiadggirysgdigkalavgassvmigsilagteespgekeligdtvykyyrgm
gsvgamksgsgdryfqekrpenkmvpegiegrvkykgemegvvyqlvgglrscmgylgsa
sieelwkkssyveitts

Sequence, based on observed residues (ATOM records): (download)

>d3ffsb_ c.1.5.0 (B:) automated matches {Cryptosporidium parvum [TaxId: 5807]}
tknigkgltfedillvpnysevlprevsletkltknvslkiplissamdtvtehlmavgm
arlggigiihknmdmesqvnevlkvknwisaysnenldnkgrlrvgaaigvneierakll
veagvdvivldsahghslniirtlkeikskmnidvivgnvvteeatkeliengadgikvg
iivagvgvpqitaiekcssvaskfgipiiadggirysgdigkalavgassvmigsilagt
eespgekeligdtvykyrvkykgemegvvyqlvgglrscmgylgsasieelwkkssyvei
tts

SCOPe Domain Coordinates for d3ffsb_:

Click to download the PDB-style file with coordinates for d3ffsb_.
(The format of our PDB-style files is described here.)

Timeline for d3ffsb_: