Lineage for d3ffna5 (3ffn A:533-628)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210161Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2210162Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2210163Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2210164Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2210181Species Human (Homo sapiens) [TaxId:9606] [55761] (39 PDB entries)
    Uniprot P20065 55-179
  8. 2210253Domain d3ffna5: 3ffn A:533-628 [246121]
    automated match to d1d0na5

Details for d3ffna5

PDB Entry: 3ffn (more details), 3 Å

PDB Description: crystal structure of calcium-free human gelsolin
PDB Compounds: (A:) gelsolin

SCOPe Domain Sequences for d3ffna5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ffna5 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOPe Domain Coordinates for d3ffna5:

Click to download the PDB-style file with coordinates for d3ffna5.
(The format of our PDB-style files is described here.)

Timeline for d3ffna5: