![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (4 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
![]() | Protein C-terminal domain of ribosomal protein L2 [50115] (2 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (18 PDB entries) |
![]() | Domain d1ffka1: 1ffk A:91-237 [24612] Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka2, d1ffkc_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffkz_ CA-atoms only; includes the C-terminal tail complexed with cd, k, mo3; mutant |
PDB Entry: 1ffk (more details), 2.4 Å
SCOP Domain Sequences for d1ffka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffka1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1ffka1: