Lineage for d1ffka1 (1ffk A:91-237)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165690Superfamily b.34.5: Translation proteins SH3-like domain [50104] (3 families) (S)
  5. 165717Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 165718Protein C-terminal domain of ribosomal protein L2 [50115] (2 species)
  7. 165719Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (7 PDB entries)
  8. 165722Domain d1ffka1: 1ffk A:91-237 [24612]
    Other proteins in same PDB: d1ffk11, d1ffk12, d1ffka2, d1ffkb_, d1ffkc_, d1ffkd_, d1ffke_, d1ffkf_, d1ffkg_, d1ffkh_, d1ffki_, d1ffkj_, d1ffkk_, d1ffkl_, d1ffkm_, d1ffkn_, d1ffko_, d1ffkp_, d1ffkq_, d1ffkr_, d1ffks_, d1ffkt_, d1ffku_, d1ffkv_, d1ffkw_, d1ffkx_, d1ffky_, d1ffkz_

Details for d1ffka1

PDB Entry: 1ffk (more details), 2.4 Å

PDB Description: crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution

SCOP Domain Sequences for d1ffka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffka1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvggggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

SCOP Domain Coordinates for d1ffka1:

Click to download the PDB-style file with coordinates for d1ffka1.
(The format of our PDB-style files is described here.)

Timeline for d1ffka1: