SCOPe 2.05: Domain d3ffke1: 3ffk E:5-146

Lineage for d3ffke1 (3ffk E:5-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)

8. Domain d3ffke1: 3ffk E:5-146 [246115]
   Other proteins in same PDB: d3ffka1, d3ffka2, d3ffka3, d3ffkb2, d3ffkd1, d3ffkd2, d3ffkd3, d3ffke2
   automated match to d1c0fa1
   complexed with atp, ca

Details for d3ffke1

PDB Entry: 3ffk, 3 Å

PDB Description: crystal structure of human gelsolin domains g1-g3 bound to actin

PDB Compounds: (E:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3ffke1:

Sequence, based on SEQRES records:

>d3ffke1 c.55.1.0 (E:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d3ffke1 c.55.1.0 (E:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrpkdsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

Timeline for d3ffke1:

• d3ffke1 first appeared in SCOPe 2.04
  
• d3ffke1 appears in SCOPe 2.06
  
• d3ffke1 appears in the current release, SCOPe 2.08